DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ACTRT1

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_612146.1 Gene:ACTRT1 / 139741 HGNCID:24027 Length:376 Species:Homo sapiens


Alignment Length:412 Identity:135/412 - (32%)
Similarity:197/412 - (47%) Gaps:59/412 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPACVIDVGTGYSKLGFAGNKEPQFIIPSAIA-IKESARVGDTNTRRITKGIEDLDFFIGDEA-F 67
            :||.:.|.|:|..|.|.:|...|:.:|.|.:. .|.:..:...|.:          :|:|.|| :
Human     9 VPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK----------YFVGQEALY 63

  Fly    68 DATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132
            ......:.||:..|||..||.||:..:....:.|..:|.....|:|||.||..|.||..||:|||
Human    64 KYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMFE 128

  Fly   133 TFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAG 197
            ||:|||.|::..||.||.||        ..:||:|||||||||..:|:.|||.:...:..:.:||
Human   129 TFSVPGFYLSNHAVAALYAS--------ACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAG 185

  Fly   198 RNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSG-VNT 261
            |:||..:..||.......|...:......||||.|||.           .||.|.:|...| |..
Human   186 RDITEHLTRLLFASGFNFPCILNKAVVNNIKEKLCYIA-----------LEPEKELRKSRGEVLG 239

  Fly   262 VTKAPFN--VDVGYERFLGPEIFFHPE---FSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVL 321
            ..:.|..  :..|.|.:..||:.|.|:   ..:|.    ||::|.:.|..|..|::..||.:|||
Human   240 AYRLPDGHVIHFGDELYQVPEVLFAPDQLGIHSPG----LSKMVSSSIMKCDTDIQNKLYADIVL 300

  Fly   322 SGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQR-YAVWFGGSMLA 385
            |||:|:......||.:::           |.|:.   |..||.   ||....| ::.|.|.|::.
Human   301 SGGTTLLPGLEERLMKEV-----------EQLAS---KGTPIK---ITASPDRCFSAWIGASIMT 348

  Fly   386 STPEFYQVCHTKAAYEEYGPSI 407
            |...|.|:..|.|.::|||.|:
Human   349 SMSSFKQMWVTSADFKEYGTSV 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 135/412 (33%)
ACTRT1NP_612146.1 ACTIN 9..376 CDD:214592 135/412 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.