DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actl7a

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_033741.1 Gene:Actl7a / 11470 MGIID:1343051 Length:440 Species:Mus musculus


Alignment Length:418 Identity:129/418 - (30%)
Similarity:201/418 - (48%) Gaps:80/418 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ACVIDVGTGYSKLGFAGNKEPQFIIPSAIA--IKESARVGDTNTRRITKGIEDLDFFIGDEAFDA 69
            |.|:|:|||:.|.||||..:|...|.:.:.  ..|:|:.||  .|:.|        |:|.|.|:.
Mouse    76 AVVVDLGTGFCKCGFAGLPKPTHKISTTVGKPYMETAKTGD--NRKET--------FVGHELFNP 130

  Fly    70 TGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133
            ..: .:..|:|||::.|||.::...|....:.::..||:|..|:::|||:...|||..||::|||
Mouse   131 DIHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFET 195

  Fly   134 FNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGR 198
            ||.|.::||.|:.|       |..:..|| :|:||:.|.||::|:|:.|||.:.|....:..||.
Mouse   196 FNTPAMHIAYQSRL-------SMYSYGRT-SGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGS 252

  Fly   199 NITSFIQSLLR-------EREVGIPPEQSLETAKAIKEKHCYICPDIAKE--------FAKYDTE 248
            ::|:::.:|:.       |..:||        .:.||.:.|::..|..:|        ...|...
Mouse   253 DLTTYLMNLMNNSGKHFSEDHLGI--------VEDIKTRCCFVALDPIEEKKIPAPEHEIHYTLP 309

  Fly   249 PGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRR 313
            .||.||                :|.||||..|:||.|.... ...:.|.....:.:..|.|.::|
Mouse   310 DGKEIR----------------LGQERFLCSEMFFKPSLIK-SMQLGLHTQTVSCLNKCDIALKR 357

  Fly   314 PLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQR-YAV 377
            .|..||:|.|||||.:.|..|||:::....                  |.|...:....:| .||
Mouse   358 DLMGNILLCGGSTMLRGFPNRLQKELSSMC------------------PNDTPQVNVLPERDTAV 404

  Fly   378 WFGGSMLASTPEFYQVCHTKAAYEEYGP 405
            |.|||:|||...|..:...:..|||:||
Mouse   405 WTGGSILASLQGFQPLWVHRLEYEEHGP 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 129/418 (31%)
Actl7aNP_033741.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
ACTL7A_N 6..70 CDD:293445
Required for interaction with TES. /evidence=ECO:0000250 36..56
NBD_sugar-kinase_HSP70_actin 72..440 CDD:302596 129/418 (31%)
ACTIN 74..440 CDD:214592 129/418 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.