DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and ACTL7A

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_006678.1 Gene:ACTL7A / 10881 HGNCID:161 Length:435 Species:Homo sapiens


Alignment Length:419 Identity:127/419 - (30%)
Similarity:199/419 - (47%) Gaps:82/419 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ACVIDVGTGYSKLGFAGNKEPQFIIPSAIA--IKESARVGDTNTRRITKGIEDLDFFIGDEAFDA 69
            |.|:|:||||.|.||||...|...|.:.:.  ..|:|:.||  .|:.|        |:|.| .:.
Human    71 AVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGD--NRKET--------FVGQE-LNN 124

  Fly    70 TGYSIKY--PVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132
            |...:|.  |:|||::.|||.::...|....:.::..||:|..|:::|||:...|||..||::||
Human   125 TNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFE 189

  Fly   133 TFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAG 197
            .||.|.::||.|:.|       |..:..|| :|:||:.|.||::|:|:.|||.:.|....:..||
Human   190 AFNTPAMHIAYQSRL-------SMYSYGRT-SGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAG 246

  Fly   198 RNITSFIQSLLR-------EREVGIPPEQSLETAKAIKEKHCYICPD--------IAKEFAKYDT 247
            .::|:::..||.       :.::||        .:.||:|.|::..|        :::...:|..
Human   247 SDLTAYLLGLLNSAGNEFTQDQMGI--------VEDIKKKCCFVALDPIEEKKVPLSEHTIRYVL 303

  Fly   248 EPGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVR 312
            ..||                .:.:..||||..|:||.|.... ...:.|.....:.:..|.|.::
Human   304 PDGK----------------EIQLCQERFLCSEMFFKPSLIK-SMQLGLHTQTVSCLNKCDIALK 351

  Fly   313 RPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQR-YA 376
            |.|..||:|.|||||...|..|||:::....                  |.|...:....:| .|
Human   352 RDLMGNILLCGGSTMLSGFPNRLQKELSSMC------------------PNDTPQVNVLPERDSA 398

  Fly   377 VWFGGSMLASTPEFYQVCHTKAAYEEYGP 405
            ||.|||:|||...|..:...:..|||:||
Human   399 VWTGGSILASLQGFQPLWVHRFEYEEHGP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 127/419 (30%)
ACTL7ANP_006678.1 ACTL7A_N 1..65 CDD:293445
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
Required for interaction with TES 31..51
NBD_sugar-kinase_HSP70_actin 67..435 CDD:302596 127/419 (30%)
ACTIN 69..435 CDD:214592 127/419 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.