DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Acte1

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001356763.1 Gene:Acte1 / 102636989 MGIID:2685344 Length:382 Species:Mus musculus


Alignment Length:416 Identity:121/416 - (29%)
Similarity:199/416 - (47%) Gaps:63/416 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIDVGTGYSKLGFAGNKEPQFIIPSAIA-IKESARVGDTNT-RRITKGIEDLDFFIGDEA-FDAT 70
            |.|.|:|:||:||:|.:.||.:.|:.:. :|.:...|.... :.:.:|:.:.|:|||.|. .:.|
Mouse     7 VCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTGLSGPACVFQNVLEGLGEQDWFIGAETQTNRT 71

  Fly    71 GYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFN 135
            ..::.||:..|.:.:||.:|:......:..|:..||.|..|:||.||.:.|.:....:|:|||||
Mouse    72 ELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQILFETFN 136

  Fly   136 VPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNI 200
            .|.||.|.||||:|.||       .|| :|..::||||:|:.:||..||.:......:.|||:::
Mouse   137 FPALYTANQAVLSLIAS-------GRT-SGTAIESGDGMTYFVPVMNGYPLHLSTTKLDIAGQDL 193

  Fly   201 TSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKA 265
            |.::..||.:....:.....||..:.:|:|:.|:..|...|.:|                  |.|
Mouse   194 TLYLMKLLSDNGNVLETIADLEYIRDLKDKYSYVALDYNMEMSK------------------TSA 240

  Fly   266 PF-----------NVDVGYERFLGPEIFFHP---EFSNPDFTIPLSEIVDNVIQNCPIDVRRPLY 316
            |.           .:::|.|.|:..|:.|..   |.:||...:...|    .|.:|....:|.|:
Mouse   241 PSFQKKFTLPDGKEINLGQEAFMCSEVLFDTSLLERANPGIHMLTLE----SIMSCEKSHQRTLF 301

  Fly   317 NNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGG 381
            |.|||:||::.......|:|:::.:.|.                ....|:|......:|:.|.|.
Mouse   302 NYIVLTGGTSACTGLRFRMQKEMAKVVS----------------PDFCVKVTASPYAKYSAWIGA 350

  Fly   382 SMLASTPEFYQVCHTKAAYEEYGPSI 407
            |:|:|.|.|..:..|...|.|.|||:
Mouse   351 SILSSLPLFKDMWITNHEYLEIGPSV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 121/416 (29%)
Acte1NP_001356763.1 NBD_sugar-kinase_HSP70_actin 2..382 CDD:354300 121/416 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.