DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and Actl10

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_003749645.1 Gene:Actl10 / 100911682 RGDID:6491130 Length:334 Species:Rattus norvegicus


Alignment Length:355 Identity:101/355 - (28%)
Similarity:165/355 - (46%) Gaps:56/355 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133
            |.|.:..:|::||:|.|||.:|...|:.:...|:..||....|:::.|...||.||..||::||.
  Rat    18 AGGVARAHPIKHGVVVDWDALEGLWERLMVGGLQIHPEQWPVLVSDSPSAPPEGREKVAELLFEA 82

  Fly   134 FNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGR 198
            ..||..::|..|:|||.:..|        .:|:.|::|.||.|..|:..|:........:.:||.
  Rat    83 LTVPACHMASTALLALCSVGA--------FSGLAVEAGAGVCHATPIYAGHSWHKATFRLNVAGS 139

  Fly   199 NITSFIQSLLREREVGIPPEQSL-----ETAKAIKEKHCY--------ICPDIAKEFAKYDTEPG 250
            .::.:.:.||    |...|:..|     :|...:|::.||        ||.....:.|.:....|
  Rat   140 TLSRYFRDLL----VASCPDLQLHALPRKTVTQLKKRCCYVSLDFQGDICDPARHQRACFCLGKG 200

  Fly   251 KWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPE-FSNPDFTIPLSEIVDNVIQNCPIDVRRP 314
            .::|                :|.|||..||..|.|. ..:|:..:|  .:....:|..|..:|..
  Rat   201 CYVR----------------LGSERFRCPEPIFQPSLLGHPEPGLP--TLAFQALQKIPTTLRTR 247

  Fly   315 LYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWF 379
            |.|.:||:||||:|..|..|:..:::         ::....|....:|.   ::.|..:..|||.
  Rat   248 LANTVVLAGGSTLFPGFVERMNLELQ---------AQCRRHGYPALQPC---LVAHPGRGTAVWT 300

  Fly   380 GGSMLASTPEFYQVCHTKAAYEEYGPSICR 409
            ||||:||...|.:...|:|.|:||||.:.|
  Rat   301 GGSMMASLHSFQRRWMTRAMYQEYGPFLVR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 101/355 (28%)
Actl10XP_003749645.1 NBD_sugar-kinase_HSP70_actin 25..329 CDD:302596 98/345 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.