DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and LOC100288966

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001244291.1 Gene:LOC100288966 / 100288966 -ID:- Length:584 Species:Homo sapiens


Alignment Length:291 Identity:57/291 - (19%)
Similarity:100/291 - (34%) Gaps:101/291 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EQCVFKYL-----RAEPED------HYFLLTEPPLNTPENREYTAEIMFETFNVPG---LYIAV- 143
            ::||...|     |..|::      ||.:..|..|.......|.|:|  |:.|..|   |.:.| 
Human   219 DECVLMLLEHGADRNIPDEYGNTALHYAIYNEDKLMAKALLLYGADI--ESKNKCGLTPLLLGVH 281

  Fly   144 ----QAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFI 204
                |.|..|....|:.:         |:|.......::.|..|                 ::.|
Human   282 EQKQQVVKFLIKKKANLN---------VLDRYGRTALILAVCCG-----------------SASI 320

  Fly   205 QSLLREREVGIPPEQ-SLETAK--AIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKAP 266
            .:||.|:.|.:..:. |.:||:  |:...|..|| ::..::.:      |.:...|..|      
Human   321 VNLLLEQNVDVSSQDLSGQTAREYAVSSHHHVIC-ELLSDYKE------KQMLKISSEN------ 372

  Fly   267 FNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDN----VIQNCPID--VRRPLYNNIVLSGGS 325
                                 |||:..:.|:...::    |.:|...:  .:.|..|        
Human   373 ---------------------SNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEIN-------- 408

  Fly   326 TMFKDFGRRLQRDIKRSVDTRLRISENLSEG 356
               ||..|.::.:||:.....:.:.|||:.|
Human   409 ---KDCDREVEEEIKKHGSNPVGLPENLTNG 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 57/291 (20%)
LOC100288966NP_001244291.1 Ank_4 143..193 CDD:290365
ANK 167..292 CDD:238125 19/74 (26%)
ANK repeat 174..203 CDD:293786
Ank_2 177..269 CDD:289560 13/51 (25%)
ANK repeat 205..236 CDD:293786 4/16 (25%)
ANK 233..357 CDD:238125 33/152 (22%)
ANK repeat 238..269 CDD:293786 8/32 (25%)
Ank_2 243..335 CDD:289560 25/119 (21%)
ANK repeat 271..302 CDD:293786 8/39 (21%)
ANK repeat 304..335 CDD:293786 7/47 (15%)
SH3_and_anchor <440..556 CDD:275056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.