DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp3 and POTEB2

DIOPT Version :9

Sequence 1:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001264232.1 Gene:POTEB2 / 100287399 HGNCID:48327 Length:544 Species:Homo sapiens


Alignment Length:162 Identity:32/162 - (19%)
Similarity:60/162 - (37%) Gaps:54/162 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 IQSLLREREVGIPPEQ-SLETAK--AIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKA 265
            |.:||.|:.|.:..:. |.:||:  |:...|..|| ::..::.:      |.:...|..|     
Human   283 IVNLLLEQNVDVSSQDLSGQTAREYAVSSHHHVIC-ELLSDYKE------KQMLKISSEN----- 335

  Fly   266 PFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDN----VIQNCPID--VRRPLYNNIVLSGG 324
                                  |||:..:.|:...::    |.:|...:  .:.|..|       
Human   336 ----------------------SNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEIN------- 371

  Fly   325 STMFKDFGRRLQRDIKRSVDTRLRISENLSEG 356
                ||..|.::.:||:.....:.:.|||:.|
Human   372 ----KDCDREVEEEIKKHGSNPVGLPENLTNG 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 32/162 (20%)
POTEB2NP_001264232.1 ANK 130..255 CDD:238125
ANK 1 135..167
ANK repeat 137..166 CDD:293786
ANK 2 168..200
ANK repeat 168..199 CDD:293786
ANK 196..320 CDD:238125 12/37 (32%)
ANK 3 201..233
ANK repeat 201..232 CDD:293786
ANK 4 234..266
ANK repeat 234..265 CDD:293786
ANK 5 267..299 5/15 (33%)
ANK repeat 267..298 CDD:293786 5/14 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..457 19/106 (18%)
SMC_N <412..>542 CDD:330553
CCDC144C 489..>542 CDD:317340
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.