DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and LRP11

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_116221.3 Gene:LRP11 / 84918 HGNCID:16936 Length:500 Species:Homo sapiens


Alignment Length:102 Identity:44/102 - (43%)
Similarity:64/102 - (62%) Gaps:2/102 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 TATIAVLKETDYAPVANAGDAVILYLPNNNVTLNGTASSDDHEIVAWEWTKDASDEAKAVDMQNT 577
            ||..:..:|.|..|::.||..|:|:||.:.|.|:|..|:|||.||.:||.....|  .:|||:..
Human   197 TARASPRQEKDAPPLSKAGQDVVLHLPTDGVVLDGRESTDDHAIVQYEWALLQGD--PSVDMKVP 259

  Fly   578 RTPYVQLSNLEEGMYTFVLKVTDGSGQSSTAKVHVFV 614
            ::..::||:|:||.|||.|.|||.:||.|:..|.|.|
Human   260 QSGTLKLSHLQEGTYTFQLTVTDTAGQRSSDNVSVTV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649
PKD <454..518 CDD:214510 2/4 (50%)
PKD 527..615 CDD:214510 39/88 (44%)
PKD 716..805 CDD:238084
LRP11NP_116221.3 MANEC 84..184 CDD:129004
PKD 208..296 CDD:238084 39/89 (44%)
LDLa 310..344 CDD:238060
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..445
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.