DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and TFPI2

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_006519.1 Gene:TFPI2 / 7980 HGNCID:11761 Length:235 Species:Homo sapiens


Alignment Length:238 Identity:51/238 - (21%)
Similarity:84/238 - (35%) Gaps:79/238 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   820 PMGISVLV----QSELDSVVQK----------LQLLLGDENKIQVRELKYDLHTDATVLVFYVN- 869
            |:|:|:|:    ::.|....|:          |.|..|....:.:| ..||.:|.:.....|.. 
Human     6 PLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLR-YYYDRYTQSCRQFLYGGC 69

  Fly   870 DGQG------KALDGL-----QVERQLRTQLQKDASILGA---FAVDIRTSVCQSDCSG--H--- 915
            :|..      :|.|..     :|.:..|.|:..|....|:   :..::.:..|:...||  |   
Human    70 EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNR 134

  Fly   916 ------------GSCNP--ITRAC-------ICEAFWMPSAGYFFNNQEANCDWSILYVFVGVIV 959
                        |.|.|  |...|       :|.|   ....|:||.:...|| :..|      .
Human   135 IENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSA---NVTRYYFNPRYRTCD-AFTY------T 189

  Fly   960 GC-----LLLSGVFWGIACA---CRQSKKPRLR-----QKVQK 989
            ||     ..:|......|||   .::.|.|:||     :|::|
Human   190 GCGGNDNNFVSREDCKRACAKALKKKKKMPKLRFASRIRKIRK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649
PKD <454..518 CDD:214510
PKD 527..615 CDD:214510
PKD 716..805 CDD:238084
TFPI2NP_006519.1 KU 34..86 CDD:238057 11/52 (21%)
Kunitz_BPTI 95..149 CDD:278443 9/53 (17%)
Kunitz_BPTI 157..204 CDD:278443 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142970
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.