DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and spint1b

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_001104693.1 Gene:spint1b / 797346 ZFINID:ZDB-GENE-071218-1 Length:499 Species:Danio rerio


Alignment Length:191 Identity:57/191 - (29%)
Similarity:83/191 - (43%) Gaps:46/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 DYAPVANAGDAVILYLPNNNVTLNGTASSDDHEIVAWEWTKDASDEAKAVDMQNTR-TPYVQLSN 586
            |..|:||||..|::. ||.:|.|||..|.||.|||.:||:....:  |:|.|:.|. ...:::||
Zfish   136 DSPPIANAGRDVVVQ-PNEDVLLNGNESWDDKEIVNYEWSLTRGN--KSVHMEKTNFRDQIRVSN 197

  Fly   587 LEEGMYTFVLKVTDGSGQSSTAKVHVFVKPPTNSPPVAEAGSNTTTSLPINWVLLNGSDSKDDIG 651
            |..|:|.|.|.|||.:.||.:|:|.|.|                          |....|:    
Zfish   198 LIPGVYEFKLTVTDSADQSDSAQVIVLV--------------------------LTSEQSE---- 232

  Fly   652 IKSYLWKQLSGPNNAVILKSNSSIANATSLTLGLYEFELTVADENN--------NTATDTT 704
             :..|..:.:||..|..::.|   .||.|.....:.|...:.:.||        |...:||
Zfish   233 -RHCLTPKKTGPCRASFIRWN---YNAASRRCEQFIFGGCMENSNNYLSETECQNACENTT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649
PKD <454..518 CDD:214510
PKD 527..615 CDD:214510 38/88 (43%)
PKD 716..805 CDD:238084
spint1bNP_001104693.1 MANEC 31..116 CDD:284837
PKD 148..225 CDD:214510 33/79 (42%)
Kunitz_BPTI 235..285 CDD:278443 12/52 (23%)
LDLa 308..342 CDD:238060
Kunitz_BPTI 363..413 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.