DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and EPPIN

DIOPT Version :10

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_065131.1 Gene:EPPIN / 57119 HGNCID:15932 Length:133 Species:Homo sapiens


Alignment Length:30 Identity:10/30 - (33%)
Similarity:14/30 - (46%) Gaps:5/30 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 PQQCVPLQPNAVRGVCTCPEGFVWNKQRKC 287
            |::|    |. :|..|...|..|..|.|:|
Human    30 PRRC----PK-IREECEFQERDVCTKDRQC 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:471454
myxo_dep_M36 <428..810 CDD:468355
EPPINNP_065131.1 Kunitz_eppin 75..131 CDD:438654
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.