| Sequence 1: | NP_648171.1 | Gene: | CG7565 / 38893 | FlyBaseID: | FBgn0035833 | Length: | 1069 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_065131.1 | Gene: | EPPIN / 57119 | HGNCID: | 15932 | Length: | 133 | Species: | Homo sapiens |
| Alignment Length: | 30 | Identity: | 10/30 - (33%) |
|---|---|---|---|
| Similarity: | 14/30 - (46%) | Gaps: | 5/30 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 258 PQQCVPLQPNAVRGVCTCPEGFVWNKQRKC 287 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7565 | NP_648171.1 | MANEC | 52..153 | CDD:471454 | |
| myxo_dep_M36 | <428..810 | CDD:468355 | |||
| EPPIN | NP_065131.1 | Kunitz_eppin | 75..131 | CDD:438654 | |
| Blue background indicates that the domain is not in the aligned region. | |||||