DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and wfikkn2b

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:XP_699239.1 Gene:wfikkn2b / 570642 ZFINID:ZDB-GENE-110414-1 Length:563 Species:Danio rerio


Alignment Length:302 Identity:54/302 - (17%)
Similarity:93/302 - (30%) Gaps:126/302 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SVGGSISPNLVCH----KMLRHVFENATPRDEQQAGVFEEYKPPPDAVEPLEEEAYLW------- 99
            :.|||:..|....    :.:..|..:|.|.||.       :|.|..  :...||...|       
Zfish   285 NAGGSVQANFPLSVSKPEAVVQVNASAVPVDEC-------FKAPDS--DDCGEEKLSWFFDPQRN 340

  Fly   100 ---------------------NCLQACCEKPRNGSSACNVVLVFKAKC--YHIR----------- 130
                                 :|:.:|.   .|.|::| ::.:.|..|  |.:|           
Zfish   341 SCNTFTYRNCSSNRNHFDDYESCMSSCL---LNISASC-MLPIHKGPCKAYELRWAYSSTLHQCR 401

  Fly   131 ------CQSNE----------------------ACLPKLRVRMPNEKVQMVLVNPLGDATWPQ-- 165
                  |::||                      ||.|:.::.....:...|::..:.|.|..|  
Zfish   402 LFIYGGCKANENNFKSKRSCEDACPYPKNHQCKACKPRYKMVSSFCRSDFVILGRMVDLTEDQDS 466

  Fly   166 ---LLKAEAAKQNAEILPYDEAALNF--------------WKQPRRLSYLARNQETPVYEDEDFP 213
               |:..|      |||..::..|.|              |..|      ..|..|.  :::...
Zfish   467 GRALVMVE------EILKDEKMGLKFLGSELLEVTLQNMDWSCP------CPNVTTS--DEQIIF 517

  Fly   214 LADKRMNQMIFQPDENDVLAN----EELGYYDSNAKFTTCDM 251
            :.|......:.|||...|:::    ::|....|.   .|||:
Zfish   518 MGDVHNGMAVLQPDSFIVVSSVRRVQKLREVVSK---NTCDI 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649 26/173 (15%)
PKD <454..518 CDD:214510
PKD 527..615 CDD:214510
PKD 716..805 CDD:238084
wfikkn2bXP_699239.1 WAP 41..87 CDD:278522
KAZAL_FS 135..171 CDD:238052
I-set 207..298 CDD:254352 4/12 (33%)
Ig 221..298 CDD:299845 4/12 (33%)
Kunitz_BPTI 317..367 CDD:278443 6/58 (10%)
Kunitz_BPTI 375..425 CDD:278443 8/50 (16%)
NTR_like 443..551 CDD:295338 21/121 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.