DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and lrp11

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:XP_005160377.1 Gene:lrp11 / 569216 ZFINID:ZDB-GENE-030131-7847 Length:544 Species:Danio rerio


Alignment Length:290 Identity:72/290 - (24%)
Similarity:116/290 - (40%) Gaps:46/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 LWTLISQPKGPMNGTISDQSKSKVKLSNLSEGLYTFKVTV------------TGDNGTFGEATAN 418
            ||  :|...|..:   |..|:.|.::|.:.|.|..|:..:            .||....|...|.
Zfish    15 LW--VSSSAGARS---SPTSELKSRISGVEELLEEFRKQLQQDEPSSREQEGDGDRCVAGFRAAE 74

  Fly   419 VTVLPENR--------INQPPQVII---SPREQIIRQPTTNAILDGSTSTDDDKITNWHW----- 467
            ..::..:.        ::.||:|..   ..|........|.||:.......||.:..:.:     
Zfish    75 SRIIRASASIEQGAAFLSAPPRVFSWRDCARACCSLPHCTVAIIQEDLKQPDDSLRCYLFNCTYR 139

  Fly   468 --EVISGPIGYQPVLPEVNTLQLDLTSPGNYTFKLTVTD--SNNVTNSTTATIAVLKETDYAPVA 528
              .|.|  ..|||.....:.|.....:||.     ..||  :.....:.....|::::.|..|.:
Zfish   140 GKSVCS--FSYQPGFSTYSRLNDSSGAPGT-----AATDRPAGRPAPALGEEEAMMQDLDEPPRS 197

  Fly   529 NAGDAVILYLPNNNVTLNGTASSDDHEIVAWEWTKDASDEAKAVDMQNTRTPYVQLSNLEEGMYT 593
            :||..:::.||.:...|:|..|:|||.|..:||.....|  .:|.|:.|....::||.|.||:||
Zfish   198 DAGQDLVVQLPTDWAVLDGRDSTDDHHITRYEWALVRGD--PSVKMKVTHPGLLKLSGLREGVYT 260

  Fly   594 FVLKVTDGSGQSSTAKVHVFVKPPTNSPPV 623
            |.:.|.|.:||.|:..|.|.|..|..:..|
Zfish   261 FEITVIDTAGQKSSDNVSVSVLAPAPNAQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649
PKD <454..518 CDD:214510 12/72 (17%)
PKD 527..615 CDD:214510 32/87 (37%)
PKD 716..805 CDD:238084
lrp11XP_005160377.1 LolA 12..>64 CDD:302782 11/53 (21%)
MANEC 66..154 CDD:284837 16/89 (18%)
LDLa 295..329 CDD:238060
KU 379..432 CDD:238057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.