DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and wfikkn2a

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:XP_693394.5 Gene:wfikkn2a / 564992 ZFINID:ZDB-GENE-120914-1 Length:573 Species:Danio rerio


Alignment Length:308 Identity:59/308 - (19%)
Similarity:101/308 - (32%) Gaps:108/308 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 TTCDMETPCPPPQQCVPLQP--NAVRGVCTC-----------------PEGF------------- 279
            :||..|  |...|.|.|.:.  :.|.|:.:|                 |:|.             
Zfish    59 STCARE--CESDQDCEPFEKCCSNVCGLKSCVAARYMDIQGRKGPMGMPKGVTCDKFMCTQQGSE 121

  Fly   280 --VWNKQ-------------------------RKCVMAAVPYSSYLTSNEAG-QQEAAASENSP- 315
              :|:.|                         .||.|.|...:..:|..|.. :...:.|..|| 
Zfish   122 CEIWDGQPVCKCKDRCGREPFFTCASDGMTYYNKCYMDAEACTRGITLTEVTCRYHFSLSNTSPL 186

  Fly   316 --EVSTPPLKAE---QNKDIV-VSVMSKEVRLPEQEVTLAAFTVP--DEQTSDTKYKYLWTLISQ 372
              |.:..|..|.   ...||. .:::||    |.........|..  .|.|...|....|.  .|
Zfish   187 PVETTARPTTAHPITTPMDIQRPAMLSK----PAHHFVFVGETASFLCEVTGKPKPAITWE--KQ 245

  Fly   373 PKGPMNGTI-SDQSKSKVKLSNLSE-----------GLYTFKVTVTGDNGTFGEATANVTVLPEN 425
            .:|..|..: .:..:..:.::|:.:           |:||  .|.|...|:. :|...::|:|..
Zfish   246 IEGKENTVMRPNHMQGNIVVTNIGQLVIYNAQVQDAGIYT--CTATNQGGSV-QAHFPLSVVPRE 307

  Fly   426 RINQPPQVIIS---PREQIIRQPTTNAILDGSTSTDD--DKITNWHWE 468
            :: :|..|:.|   |.|:.::.|          ..||  ::...|::|
Zfish   308 QL-KPVLVMNSTRLPAEECLKAP----------DMDDCGEESMRWYYE 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649
PKD <454..518 CDD:214510 4/17 (24%)
PKD 527..615 CDD:214510
PKD 716..805 CDD:238084
wfikkn2aXP_693394.5 WAP 43..89 CDD:278522 10/31 (32%)
KAZAL_FS 137..173 CDD:238052 6/35 (17%)
I-set 209..303 CDD:254352 19/102 (19%)
Ig 223..303 CDD:299845 16/84 (19%)
KU 325..375 CDD:197529 5/30 (17%)
Kunitz_BPTI 382..433 CDD:278443
NTR_WFIKKN 451..559 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575827
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.