DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7565 and wfikkn1

DIOPT Version :9

Sequence 1:	NP_648171.1	Gene:	CG7565 / 38893	FlyBaseID:	FBgn0035833	Length:	1069	Species:	Drosophila melanogaster
Sequence 2:	NP_999912.1	Gene:	wfikkn1 / 406570	ZFINID:	ZDB-GENE-040426-2465	Length:	558	Species:	Danio rerio

Alignment Length:	133	Identity:	29/133 - (21%)
Similarity:	50/133 - (37%)	Gaps:	21/133 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   616 PPTNSPPVAEAGSNTTTSLPINW-------VLLNGSDS--KDDIG--IKSYLWKQLSGPNNAVIL 669
            |...:||.|...::|.||.|..:       ..|.|:.|  .|.||  .....|::.|.....|::
Zfish   174 PQDPTPPPAPTDADTQTSAPTLYSSPQQQVTYLGGTVSFHCDVIGQPKPEVTWEKQSDEQEQVVM 238

  Fly   670 KSNSSIANATSLTLG-LYEFELTVADENNNTATDTTWVKIVQERNAAPIANAGGDHTVTLPATAI 733
            :::....|....::| |..:...|.|..         :.....||:|.:..|....:|...|...
Zfish   239 RADQMFGNVVITSIGQLVVYNAQVWDSG---------IYSCVARNSAGVLRADFSLSVVSHADQD 294

  Fly   734 YFN 736
            :|:
Zfish   295 FFD 297

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7565	NP_648171.1	MANEC	52..153	CDD:297649
		PKD	<454..518	CDD:214510
		PKD	527..615	CDD:214510
		PKD	716..805	CDD:238084	4/21 (19%)
wfikkn1	NP_999912.1	WAP	27..73	CDD:278522
		KAZAL_FS	124..160	CDD:238052
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	167..194		7/19 (37%)
		I-set	199..287	CDD:254352	18/96 (19%)
		Ig	207..287	CDD:299845	17/88 (19%)
		Kunitz_BPTI	314..364	CDD:278443
		Kunitz_BPTI	370..421	CDD:278443
		NTR_WFIKKN	439..547	CDD:239630
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170575829
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930