DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and tfpia

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_001296732.1 Gene:tfpia / 359833 ZFINID:ZDB-GENE-030711-1 Length:279 Species:Danio rerio


Alignment Length:154 Identity:36/154 - (23%)
Similarity:57/154 - (37%) Gaps:48/154 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   877 DGLQVERQLRTQ---LQKD----ASILGAFAVDIRTSVCQ----SDCSGHGSCNPITRACICEAF 930
            ||::.|.::..|   |:||    .::...|..||.|..|:    ..|  .|:.|.......||..
Zfish    29 DGVRSELRIFHQSCALKKDEGPCKAMKDRFYFDIDTGRCEPFEYGGC--QGNANNFETLQDCEEM 91

  Fly   931 WM---------------PSAG----YFFNNQEANCDWSILYVFVGVIVGCLLLSGVFWGIACACR 976
            .:               |..|    |||:.:...|.    ..|.|   ||...:..|..|. || 
Zfish    92 CLVTENKSPCHLEDEPGPCRGLVPRYFFDQKSQECK----QFFYG---GCFGNANNFKTIK-AC- 147

  Fly   977 QSKKPRLRQKVQKYSLIGNKDEEA 1000
                   :|:.|..:::.:::|||
Zfish   148 -------QQRCQLTAVLKSEEEEA 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649
PKD <454..518 CDD:214510
PKD 527..615 CDD:214510
PKD 716..805 CDD:238084
tfpiaNP_001296732.1 Kunitz_BPTI 42..92 CDD:278443 13/51 (25%)
KU 99..151 CDD:238057 15/67 (22%)
Kunitz_BPTI 205..256 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.