DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and Spint1

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_001004265.2 Gene:Spint1 / 311331 RGDID:1303138 Length:507 Species:Rattus norvegicus


Alignment Length:237 Identity:47/237 - (19%)
Similarity:75/237 - (31%) Gaps:73/237 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 DMETPCPPPQQC----VPLQPNAVRGV--------CTCPEGFVWNKQRKCVMAAVP-YSSYLTSN 301
            |....|...|.|    |.|||:.....        |...:.||      |..|... :.:|||.:
  Rat    80 DCVRACCTTQNCNLALVELQPDGGEDAISACFLMNCLYEQNFV------CKFAPKDGFINYLTQD 138

  Fly   302 EAGQQEAAASENSPEVSTP------PLKAEQNKDIVVSVMSKEVRLPEQEVTLAAFTVPDEQTSD 360
            .........:........|      .||.:..|.:|:.                     |...:|
  Rat   139 LYNSYRELRTRGFGGSRIPRIWMGIDLKVQLQKPLVLR---------------------DADNTD 182

  Fly   361 TKYKYLWTLISQPKGPMNGTISDQSKSKVKLSNLSEGLYTFKVTVTGDNGTFGEATANVTV---- 421
                  |.|:   :|..:.::......:|:|..|.||.|.|::|.|..:..  |.|.|:|:    
  Rat   183 ------WHLL---QGDQDVSVKRNHPEEVELWGLKEGTYLFQLTRTDSDQL--EETVNLTITVLT 236

  Fly   422 --------LPENRINQP----PQVIISPREQIIRQPTTNAIL 451
                    |...::.:.    |:....|:|||.:..|....|
  Rat   237 AEQTEDYCLASYKVGRCRGSFPRWYYDPKEQICKSFTFGGCL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649
PKD <454..518 CDD:214510
PKD 527..615 CDD:214510
PKD 716..805 CDD:238084
Spint1NP_001004265.2 MANEC 44..133 CDD:284837 13/58 (22%)
Kunitz_BPTI 243..295 CDD:278443 8/36 (22%)
LDLa 313..344 CDD:197566
Kunitz_BPTI 368..420 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.