DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and Wfikkn2

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:XP_006533560.1 Gene:Wfikkn2 / 278507 MGIID:2669209 Length:585 Species:Mus musculus


Alignment Length:404 Identity:62/404 - (15%)
Similarity:119/404 - (29%) Gaps:129/404 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PLEEEAYLWNCLQACCEKPRNGSSACNVVLVFKAKCYHIRCQSNEACLPKLRVRMPNEKVQMVLV 155
            |.:....||...|:.|::.......|...    .||....| ..::|:....:.:..:|      
Mouse    56 PNDMNPNLWVDAQSTCKRECETDQECETY----EKCCPNVC-GTKSCVAARYMDVKGKK------ 109

  Fly   156 NPLGDATWPQLLKAEAAKQNAEILPYDEAALNFWKQPRRLSYLARNQETPVYEDEDFPLADKRMN 220
            .|:|                   :|.:....:|       ..|.:..|..:::.:.......|. 
Mouse   110 GPVG-------------------MPKEATCDHF-------MCLQQGSECDIWDGQPVCKCKDRC- 147

  Fly   221 QMIFQPDENDVLANEELGYYDSNAKFTTCDMETPCPPPQQCVPLQPNAVRGVCTCPEGFVWNKQR 285
                :.:.:...|::.|.||:      .|.|:.     :.|   .......|.||...|.|..  
Mouse   148 ----EKEPSFTCASDGLTYYN------RCFMDA-----EAC---SKGITLSVVTCRYHFTWPN-- 192

  Fly   286 KCVMAAVPYSSYLTSNEAGQQEAAASENSPEVSTPPLKAEQNKDIVVSVMSKEVRLPEQEVTLAA 350
               .:..|..:.:....|..:.......:|.:...|:.........||.:...|..|..|:|.  
Mouse   193 ---TSPPPPETTVHPTTASPETLGLDMAAPALLNHPVHQSVTVGETVSFLCDVVGRPRPELTW-- 252

  Fly   351 FTVPDEQTSDTKYKYLWTLISQPKGPMNGTISDQSKSKVKLSNLSE-----------GLYT---- 400
                ::|..|.:     .::.:|         :..:..|.::|:::           |:||    
Mouse   253 ----EKQLEDRE-----NVVMRP---------NHVRGNVVVTNIAQLVIYNVQPQDAGIYTCTAR 299

  Fly   401 ---------FKVTVT--GDNGTFGEATANVTVLPENRINQPPQVIISPREQIIRQPTTNAILDGS 454
                     |.::|.  |......|::.|.|..|.....:||.......||              
Mouse   300 NVAGVLRADFPLSVVRGGQARATSESSLNGTAFPATECLKPPDSEDCGEEQ-------------- 350

  Fly   455 TSTDDDKITNWHWE 468
                    |.||::
Mouse   351 --------TRWHFD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649 11/61 (18%)
PKD <454..518 CDD:214510 3/15 (20%)
PKD 527..615 CDD:214510
PKD 716..805 CDD:238084
Wfikkn2XP_006533560.1 WAP 51..100 CDD:365870 10/48 (21%)
KAZAL_FS 147..183 CDD:238052 8/54 (15%)
Ig_3 233..313 CDD:143242 15/99 (15%)
KU 337..388 CDD:238057 7/42 (17%)
Kunitz_BPTI 394..445 CDD:333766
NTR_WFIKKN 464..572 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.