DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and T21D12.7

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_001343686.1 Gene:T21D12.7 / 24104914 WormBaseID:WBGene00020648 Length:661 Species:Caenorhabditis elegans


Alignment Length:168 Identity:34/168 - (20%)
Similarity:65/168 - (38%) Gaps:38/168 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   810 KLLNLVQMTLPMGISV--LVQSELDSVVQKLQLLLGDENKIQVRELKYDLHTDATVLVFYVNDGQ 872
            |...:.|:.|.:|::|  |..:||...|.:|...:|....:......|...::....:.::.:|.
 Worm     4 KTSTIFQILLLLGVTVIHLDGNELGGFVCRLPKNVGFACGVTTPHSAYYFDSEIRECIEFMFEGC 68

  Fly   873 G----------KALDGLQVERQLRTQLQKDASILGAFAVDIRTSVCQSD---CSGHGSC--NPIT 922
            |          :.::|.    :..||..|...::. ||.:|:.  |..:   |.|...|  |.::
 Worm    69 GGNQNRFSSRQECINGC----KSLTQCGKGMPLMD-FAGNIKR--CDGERVPCPGSHECVGNGMS 126

  Fly   923 RAC------ICEAF--------WMPSAGYFFNNQEANC 946
            ..|      ||:|.        ..|:..|:|::....|
 Worm   127 SVCCQKAGRICQASVHPGTPCGVPPATRYYFDSSSKTC 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649
PKD <454..518 CDD:214510
PKD 527..615 CDD:214510
PKD 716..805 CDD:238084
T21D12.7NP_001343686.1 Kunitz_BPTI 31..86 CDD:278443 7/58 (12%)
Lustrin_cystein 91..131 CDD:317074 10/42 (24%)
Kunitz_BPTI 136..189 CDD:278443 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.