DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and WFDC6

DIOPT Version :10

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_543017.1 Gene:WFDC6 / 140870 HGNCID:16164 Length:86 Species:Homo sapiens


Alignment Length:42 Identity:11/42 - (26%)
Similarity:21/42 - (50%) Gaps:13/42 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 CDME--TPCPPPQQCVPLQPNAVRGVCTCPEGFVWNKQRKCV 288
            |::|  ..|..|:.|    |..::  | ||    :::.:||:
Human    40 CEVEEIDQCTKPRDC----PENMK--C-CP----FSRGKKCL 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:471454
myxo_dep_M36 <428..810 CDD:468355
WFDC6NP_543017.1 WAP <33..71 CDD:469631 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.