DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and WFIKKN2

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_783165.1 Gene:WFIKKN2 / 124857 HGNCID:30916 Length:576 Species:Homo sapiens


Alignment Length:266 Identity:54/266 - (20%)
Similarity:89/266 - (33%) Gaps:82/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EAYLWNCLQAC-----CEKPRNGSSACNVVLVFKAKCYHIRCQSNEACLPKLRVRMPNEKVQMVL 154
            |..:|:....|     |||..:.:.|.: .|.:..:||    ...|||         ::.:.:.:
Human   122 ECDIWDGQPVCKCKDRCEKEPSFTCASD-GLTYYNRCY----MDAEAC---------SKGITLAV 172

  Fly   155 VNPLGDATWPQLLKAEAAKQNAEILPYDEAALNFWKQPRRLSYLARNQETPVYEDEDFPLADKRM 219
            |......|||....           |..|..::                 |.....:.|..|...
Human   173 VTCRYHFTWPNTSP-----------PPPETTMH-----------------PTTASPETPELDMAA 209

  Fly   220 NQMIFQPDENDVLANEELGYYDSNAKFTTCDMETPCPPPQ----------QCVPLQPNAVRG--- 271
            ..::..|....|...|.:.:        .||: ...|.|:          :.|.::||.|||   
Human   210 PALLNNPVHQSVTMGETVSF--------LCDV-VGRPRPEITWEKQLEDRENVVMRPNHVRGNVV 265

  Fly   272 VCTCPEGFVWNKQRK------CV---MAAVPYSSYLTSNEAGQQEAAASENSPEVSTPP----LK 323
            |....:..::|.|.:      |.   :|.|..:.:..|...|.|.||.||:||..:..|    ||
Human   266 VTNIAQLVIYNAQLQDAGIYTCTARNVAGVLRADFPLSVVRGHQAAATSESSPNGTAFPAAECLK 330

  Fly   324 AEQNKD 329
            ...::|
Human   331 PPDSED 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649 13/62 (21%)
PKD <454..518 CDD:214510
PKD 527..615 CDD:214510
PKD 716..805 CDD:238084
WFIKKN2NP_783165.1 WAP 44..90 CDD:278522
KAZAL_FS 138..174 CDD:238052 10/49 (20%)
I-set 216..304 CDD:254352 19/96 (20%)
Ig_3 224..304 CDD:143242 17/88 (19%)
Kunitz_BPTI 328..379 CDD:278443 3/9 (33%)
Kunitz_BPTI 385..436 CDD:278443
NTR_WFIKKN 455..563 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.