DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and Ambp

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_031469.1 Gene:Ambp / 11699 MGIID:88002 Length:349 Species:Mus musculus


Alignment Length:219 Identity:43/219 - (19%)
Similarity:66/219 - (30%) Gaps:70/219 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 DHTVTLPATAIYFNGSKS-----WDDLAVVKYL-WTRDEHSLAAGVIVADTDKEPVMILTNLVQG 781
            |...|||...:..|.|:|     |.:|||.... |                       |:.:...
Mouse    20 DPASTLPDIQVQENFSESRIYGKWYNLAVGSTCPW-----------------------LSRIKDK 61

  Fly   782 RYVFTLTVSDDQGLTSSDTVSVNVRRDPKLLNLVQMTLPMGISVLVQSELDSVVQKLQL---LLG 843
            ..|.||.:.:....|.....|...||.                  |..|:....||..:   .|.
Mouse    62 MSVSTLVLQEGATETEISMTSTRWRRG------------------VCEEITGAYQKTDIDGKFLY 108

  Fly   844 DENKIQVRELKYDLHTDATVLVFYVNDGQGKALDGLQV-------ERQLRTQLQKDASILGAFAV 901
            .::|..:....|.:||:......::.. :.....||.:       |.|||..|.::..       
Mouse   109 HKSKWNITLESYVVHTNYDEYAIFLTK-KSSHHHGLTITAKLYGREPQLRDSLLQEFK------- 165

  Fly   902 DIRTSVCQSDCS-----GHGSCNP 920
            |:..:|..|:.|     ..|.|.|
Mouse   166 DVALNVGISENSIIFMPDRGECVP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649
PKD <454..518 CDD:214510
PKD 527..615 CDD:214510
PKD 716..805 CDD:238084 18/87 (21%)
AmbpNP_031469.1 Lipocalin 41..185 CDD:278490 33/192 (17%)
Kunitz_BPTI 230..281 CDD:278443
Kunitz_BPTI 285..337 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.