DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and SPINT2

DIOPT Version :10

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens


Alignment Length:112 Identity:26/112 - (23%)
Similarity:38/112 - (33%) Gaps:28/112 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   958 IVGCLLLSGVFWG--------------IACACRQSKKPRLRQKVQKYS----LIGNKDEEAANY- 1003
            ::|.||||||...              :...||.| .||....|...|    :.|..|..:.|| 
Human    16 LLGSLLLSGVLAADRERSIHDFCLVSKVVGRCRAS-MPRWWYNVTDGSCQLFVYGGCDGNSNNYL 79

  Fly  1004 ------SRNTSLTESETDSDVLFETRTKSNGLGKHKSHNSHSHGHGS 1044
                  .:..::||:.|..  |..:|..::...........|..|.|
Human    80 TKEECLKKCATVTENATGD--LATSRNAADSSVPSAPRRQDSEDHSS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:471454
myxo_dep_M36 <428..810 CDD:468355
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 11/52 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122 2/21 (10%)
Kunitz_HAI2_2-like 131..183 CDD:438665
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.