DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7565 and EPPIN-WFDC6

DIOPT Version :9

Sequence 1:	NP_648171.1	Gene:	CG7565 / 38893	FlyBaseID:	FBgn0035833	Length:	1069	Species:	Drosophila melanogaster
Sequence 2:	NP_001185915.1	Gene:	EPPIN-WFDC6 / 100526773	HGNCID:	38825	Length:	179	Species:	Homo sapiens

Alignment Length:	122	Identity:	25/122 - (20%)
Similarity:	41/122 - (33%)	Gaps:	48/122 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly   101 CL---QACCEKPRNGSSAC-------------NVVLVF--------------KAKCYHIRCQSNE 135
            ||   |..||.|:. :..|             |...:|              ||.|.: .|::.:
Human    69 CLDLKQDVCEMPKE-TGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLN-TCKNKQ 131

  Fly   136 ACLPKLRVRMPNEKVQMVLVNPLGDATWPQLLKAEAAKQNAEILPYD--EAALNFWK 190
            .| ||::|....|::.             |..|.....:|.:..|:.  :..|:|.|
Human   132 PC-PKIKVECEVEEID-------------QCTKPRDCPENMKCCPFSRGKKCLDFRK 174

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7565	NP_648171.1	MANEC	52..153	CDD:297649	18/81 (22%)
		PKD	<454..518	CDD:214510
		PKD	527..615	CDD:214510
		PKD	716..805	CDD:238084
EPPIN-WFDC6	NP_001185915.1	WAP	32..71	CDD:278522	1/1 (100%)
EPPIN-WFDC6	NP_001185915.1	Kunitz_BPTI	76..128	CDD:278443	9/53 (17%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165142968
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930