DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7565 and si:dkeyp-73b11.8

DIOPT Version :9

Sequence 1:NP_648171.1 Gene:CG7565 / 38893 FlyBaseID:FBgn0035833 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_001373612.1 Gene:si:dkeyp-73b11.8 / 100333708 ZFINID:ZDB-GENE-131120-176 Length:230 Species:Danio rerio


Alignment Length:177 Identity:40/177 - (22%)
Similarity:58/177 - (32%) Gaps:48/177 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   853 LKYDLHT--DATVLVFYVND----------GQGKALDGLQVERQLRTQLQKDASILGAFAVDIRT 905
            ||.|..|  |..|.::|..|          |:|...:....|:|........|..|  |.:|.: 
Zfish    29 LKQDEGTGNDVVVYMYYDADKDSCYPFRYNGEGGNSNRFITEKQCMRNCSHRADQL--FPMDGK- 90

  Fly   906 SVC-----QSDCSG----------HGSCNPI-TRACI-----------CEAFWMPSAGYFFNNQE 943
            .:|     ...|.|          |.:|.|. ...|:           |.|....||.....:..
Zfish    91 QICVLPREPGQCFGHYLRYYYSPEHHTCKPFYWTGCVGNGNRFLSLNRCNATCYNSADKGHEDHS 155

  Fly   944 ANCDWSILYVFVGVIVGCLL-LSGVFWGIACACRQSKKPRLRQKVQK 989
            ...|     |.||:|:|.:. |.|....|.......|||..:::.:|
Zfish   156 GESD-----VPVGIILGVVFGLIGAIILIVVIVFAVKKPSSKKREKK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7565NP_648171.1 MANEC 52..153 CDD:297649
PKD <454..518 CDD:214510
PKD 527..615 CDD:214510
PKD 716..805 CDD:238084
si:dkeyp-73b11.8NP_001373612.1 Kunitz_BPTI 26..77 CDD:394972 12/47 (26%)
KU 92..143 CDD:238057 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.