DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and KSS1

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_011554.3 Gene:KSS1 / 852931 SGDID:S000003272 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:305 Identity:125/305 - (40%)
Similarity:189/305 - (61%) Gaps:19/305 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFF-KHENVLSALDILQPP 109
            ||.||:|.|.:......|.:||:||: ..|...:...|..||:|:|.:| :|||::|.||.::|.
Yeast    19 IGEGAYGTVCSAIHKPSGIKVAIKKI-QPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPV 82

  Fly   110 HLDFFQEIYVITELLQSDLHKIIVSPQH----LSADHIKVFLYQILRGLKYLHSARILHRDIKPG 170
            .:|....:|::.||:::||.|:|.:...    ||.||::.|.|||||.||.:|||:::||||||.
Yeast    83 SIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPS 147

  Fly   171 NLLVNSNCVLKICDFGLAR--VEEPDQAK----HMTQEVVTQYYRAPEILMGARHYSSAVDVWSV 229
            |||:||||.||:|||||||  ....|..:    .||:.|.|::||||||::..:.|::|:|:||.
Yeast   148 NLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSC 212

  Fly   230 GCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRH-ACEGARTHMLRRAPKPP-SFSVLY 292
            |||..|::..:.||..::...||.||.|:||||:.||... ..:.|:.::.....:|| .:..::
Yeast   213 GCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVW 277

  Fly   293 TLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYH 337
            : .:....:.:.||.:||.|:||||||..:||.||||    ..||
Yeast   278 S-KTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYL----AMYH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 125/305 (41%)
KSS1NP_011554.3 PKc_like 7..365 CDD:419665 125/305 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.