DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and Cilk1

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_620241.1 Gene:Cilk1 / 84411 RGDID:71050 Length:629 Species:Rattus norvegicus


Alignment Length:404 Identity:119/404 - (29%)
Similarity:186/404 - (46%) Gaps:64/404 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDIL-Q 107
            :.:|.|.:|.|........|..:|:||:...|.|......: ||:|.|....|.|::...::: :
  Rat     8 KQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNL-REVKSLKKLNHANIVKLKEVIRE 71

  Fly   108 PPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADH-IKVFLYQILRGLKYLHSARILHRDIKPGN 171
            ..||      |.|.|.::.:|:::|.....|..:. |:..:||||:||.::|.....|||:||.|
  Rat    72 NDHL------YFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPEN 130

  Fly   172 LLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGEL 236
            ||.....::||.||||||  |.......|..|.|::|||||:|:.:.:|||.:|||:||||..|:
  Rat   131 LLCMGPELVKIADFGLAR--EIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEV 193

  Fly   237 LGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSF-SVLYTLSSHATH 300
            ...|.||...:.:..:..|.::||||...|..   ||.:.........|... :.|.||..:|:.
  Rat   194 YTLRPLFPGASEIDTIFKICQVLGTPKKTDWP---EGYQLSSAMNFIWPQCIPNNLKTLIPNASS 255

  Fly   301 EAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQP 365
            ||:.||..:|.:||.||.:.:.||.:||...|.              ..|:.  |.|    :|:|
  Rat   256 EAIQLLRDLLQWDPKKRPTASQALRYPYFQIGH--------------PLGIS--TQD----SGKP 300

  Fly   366 FDDLWER-------KLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAA---------FKSFASS 414
            ..|:.::       |.....|...:.|..|:.:           |..|:         :|..||.
  Rat   301 QKDVQDKTGPPPYVKPAPPAQAPTKAHTLISSR-----------PNQASQPHQHFVYPYKGEASR 354

  Fly   415 T--VAHPSELPPSP 426
            |  ::|..|..|:|
  Rat   355 TEQLSHVQEGQPNP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 112/385 (29%)
Cilk1NP_620241.1 STKc_MAK_like 4..284 CDD:270824 97/287 (34%)
S_TKc 4..284 CDD:214567 97/287 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..322 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..482
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..629
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.