DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MPK18

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_175756.2 Gene:MPK18 / 841786 AraportID:AT1G53510 Length:615 Species:Arabidopsis thaliana


Alignment Length:395 Identity:145/395 - (36%)
Similarity:219/395 - (55%) Gaps:61/395 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPH 110
            ||.|::|||.|..|...|.:||:||:.:||:.:..:.|:.||:|:|...:|.:::....|:.||.
plant    31 IGKGSYGVVCAAIDTHTGEKVAIKKINDVFEHISDALRILREVKLLRLLRHPDIVEIKSIMLPPS 95

  Fly   111 LDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVN 175
            ...|::|||:.||::||||::|.:...|:.:|.:.||||:||.||::|:|.:.|||:||.|:|.|
plant    96 KREFKDIYVVFELMESDLHQVIKANDDLTREHHQFFLYQMLRALKFMHTANVYHRDLKPKNILAN 160

  Fly   176 SNCVLKICDFGLARVEEPDQAKHM--TQEVVTQYYRAPEILMGA--RHYSSAVDVWSVGCIFGEL 236
            :||.||:||||||||...|....:  |..|.|::||||| |.|:  ..|:.|:||||:||||.|:
plant   161 ANCKLKVCDFGLARVAFNDTPTTVFWTDYVATRWYRAPE-LCGSFFSKYTPAIDVWSIGCIFAEV 224

  Fly   237 LGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLR------RAPKPPSFSVLYTLS 295
            |..:.||..::.|.||||||:|||||..|.:    .|.|....|      |...|.:||..:   
plant   225 LTGKPLFPGKSVVHQLELITDLLGTPKSETI----SGVRNDKARKYLTEMRKKNPVTFSQKF--- 282

  Fly   296 SHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEP 360
            |.|...|:.||.::|.|||..|.:..:|||.||.                   .|:.:  .:.||
plant   283 SKADPLALRLLQRLLAFDPKDRPTPAEALADPYF-------------------KGLSK--IEREP 326

  Fly   361 SAGQ----PFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFAS----STVA 417
            |:.|    .|:  :||:..:...::|.:::.|.|          .:||  ..|.:.|    |...
plant   327 SSQQISKMEFE--FERRRLTKDDIRELIYREILE----------YHPQ--LLKDYMSGSEGSNFV 377

  Fly   418 HPSEL 422
            :||.:
plant   378 YPSAI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 141/378 (37%)
MPK18NP_175756.2 STKc_TDY_MAPK 24..361 CDD:143364 138/370 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.