DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MPK11

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001117210.1 Gene:MPK11 / 839523 AraportID:AT1G01560 Length:369 Species:Arabidopsis thaliana


Alignment Length:349 Identity:147/349 - (42%)
Similarity:220/349 - (63%) Gaps:28/349 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALD 104
            |.|.||||.||.|:|.|..:...|..||:||:.|.|.:::.:||..||:|:|....|:||::.:|
plant    40 VPPLRPIGRGASGIVCAAWNSETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMDHDNVIAIID 104

  Fly   105 ILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKP 169
            |::||..|.|.:::::.||:.:|||.||.|.|.|:.||.:.||||:||||||:|||.:||||:||
plant   105 IIRPPQPDNFNDVHIVYELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHSANVLHRDLKP 169

  Fly   170 GNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFG 234
            .|||:|:||.|||.||||||.:  .:...||:.|||::|||||:|:....|::|:|:||||||.|
plant   170 SNLLLNANCDLKIGDFGLARTK--SETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILG 232

  Fly   235 ELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPP--SFSVLYTLSSH 297
            |::.|..||..::.||||.|||||:|:|....:...........:|:.|:.|  :|:..:   .:
plant   233 EIMTREPLFPGRDYVQQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARF---PN 294

  Fly   298 ATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSA 362
            .:..||.||.:||||||::||:|.:||.||||                   |.:.:|..  ||..
plant   295 MSVNAVDLLQKMLVFDPNRRITVDEALCHPYL-------------------APLHEYNE--EPVC 338

  Fly   363 GQPFDDLWERKLTSVQQVKEEMHK 386
            .:||...:|:...:.:.:||.:::
plant   339 VRPFHFDFEQPSLTEENIKELIYR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 147/349 (42%)
MPK11NP_001117210.1 STKc_TEY_MAPK 33..369 CDD:143363 147/349 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.