DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MPK1

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001031017.1 Gene:MPK1 / 837559 AraportID:AT1G10210 Length:370 Species:Arabidopsis thaliana


Alignment Length:345 Identity:152/345 - (44%)
Similarity:213/345 - (61%) Gaps:33/345 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDIL 106
            |.:|||.||:|||.:..:.....:||:||:.||:::.:.:.|..||||:|...:||||::..|::
plant    34 PIKPIGRGAYGVVCSSVNSDTNEKVAIKKIHNVYENRIDALRTLRELKLLRHLRHENVIALKDVM 98

  Fly   107 QPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGN 171
            .|.|...|:::|::.||:.:|||:||.|.|.||.||.:.||:|:||||||:|||.|||||:||||
plant    99 MPIHKMSFKDVYLVYELMDTDLHQIIKSSQVLSNDHCQYFLFQLLRGLKYIHSANILHRDLKPGN 163

  Fly   172 LLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGEL 236
            ||||:||.||||||||||... .:.:.||:.|||::|||||:|:...:|.:::|||||||||.||
plant   164 LLVNANCDLKICDFGLARASN-TKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEL 227

  Fly   237 LGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPP--SFSVLYTLSSHAT 299
            |||:.:||....:.||:||..:||:...||:...........:|..|..|  |.|.||. .:|..
plant   228 LGRKPIFQGTECLNQLKLIVNILGSQREEDLEFIDNPKAKRYIRSLPYSPGMSLSRLYP-GAHVL 291

  Fly   300 HEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQ 364
              |:.||.:||||||.|||||::||.|||:                     ...|..:..|.|..
plant   292 --AIDLLQKMLVFDPSKRISVSEALQHPYM---------------------APLYDPNANPPAQV 333

  Fly   365 PFDDLWERKLTSVQQVKEEM 384
            |.|      |...:.::|||
plant   334 PID------LDVDEDLREEM 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 152/345 (44%)
MPK1NP_001031017.1 STKc_TEY_MAPK 26..361 CDD:143363 152/345 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.