DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MPK14

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_195363.1 Gene:MPK14 / 829797 AraportID:AT4G36450 Length:361 Species:Arabidopsis thaliana


Alignment Length:295 Identity:148/295 - (50%)
Similarity:202/295 - (68%) Gaps:10/295 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDIL 106
            |.:|||.||:|||.:..:.....|||:||:.|||::.:.:.|..||||:|...:||||:|..|::
plant    34 PIKPIGRGAYGVVCSSINSETNERVAIKKIHNVFENRIDALRTLRELKLLRHVRHENVISLKDVM 98

  Fly   107 QPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGN 171
            .|.|...|:::|::.||:.|||::||.|.|.||.||.|.||:|:||||||||||.|||||:||||
plant    99 LPTHRYSFRDVYLVYELMDSDLNQIIKSSQSLSDDHCKYFLFQLLRGLKYLHSANILHRDLKPGN 163

  Fly   172 LLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGEL 236
            ||||:||.||||||||||..|    :.||:.|||::|||||:|:...:|.:::|||||||||.|:
plant   164 LLVNANCDLKICDFGLARTYE----QFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEI 224

  Fly   237 LGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAP--KPPSFSVLYTLSSHAT 299
            |||:.:|.....:.||:||..::|:....|::..........::..|  |...||.:|   .||.
plant   225 LGRKPIFPGTECLNQLKLIINVVGSQQDWDLQFIDNQKARRFIKSLPFSKGTHFSHIY---PHAN 286

  Fly   300 HEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRL 334
            ..|:.||.:||||||.|||||:|||.|||: ||.|
plant   287 PLAIDLLQRMLVFDPTKRISVSDALLHPYM-EGLL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 148/295 (50%)
MPK14NP_195363.1 PKc_like 26..359 CDD:304357 148/295 (50%)
S_TKc 32..316 CDD:214567 144/288 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.