DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MPK10

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_191538.1 Gene:MPK10 / 825148 AraportID:AT3G59790 Length:393 Species:Arabidopsis thaliana


Alignment Length:383 Identity:154/383 - (40%)
Similarity:228/383 - (59%) Gaps:57/383 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YQPPAVPQDVQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFK 95
            |:||.        ||||.||.|:|.:..|.....:||:||:..||.:.:.:||..||:|:|..|.
plant    59 YKPPI--------RPIGRGACGIVCSAVDSETNEKVAIKKITQVFDNTIEAKRTLREIKLLRHFD 115

  Fly    96 HENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSA 160
            |||:::..|::.||..|.|:::|::.||::.||::.:.|.|.|:.||...|:|||||||||:|||
plant   116 HENIVAIRDVILPPQRDSFEDVYIVNELMEFDLYRTLKSDQELTKDHGMYFMYQILRGLKYIHSA 180

  Fly   161 RILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVD 225
            .:||||:||.|||:::.|.||||||||||.  ..::..||:.|||::|||||:|:|:..|::|:|
plant   181 NVLHRDLKPSNLLLSTQCDLKICDFGLARA--TPESNLMTEYVVTRWYRAPELLLGSSDYTAAID 243

  Fly   226 VWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPP--SF 288
            ||||||||.|::.|..||..::.|.||.|:.||:|||:.|::....|.|:.: :|:.|..|  ||
plant   244 VWSVGCIFMEIMNREPLFPGKDQVNQLRLLLELIGTPSEEELGSLSEYAKRY-IRQLPTLPRQSF 307

  Fly   289 SVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQ 353
            :..:   .:....|:.|:.:||.|||.:||||.:|||||||..    :|.               
plant   308 TEKF---PNVPPLAIDLVEKMLTFDPKQRISVKEALAHPYLSS----FHD--------------- 350

  Fly   354 YTADFEPSAGQPFD-DLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLC----INPQSA 406
             ..| ||...:||: ||.|             |.|..||.:  .:..|    .||:::
plant   351 -ITD-EPECSEPFNFDLDE-------------HPFSEEQFR--ELIYCEALAFNPETS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 151/375 (40%)
MPK10NP_191538.1 PKc_like 53..388 CDD:304357 152/378 (40%)
S_TKc 63..345 CDD:214567 133/295 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.