DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MPK12

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001325006.1 Gene:MPK12 / 819215 AraportID:AT2G46070 Length:406 Species:Arabidopsis thaliana


Alignment Length:347 Identity:140/347 - (40%)
Similarity:205/347 - (59%) Gaps:24/347 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALD 104
            |.|.||||.||.|:|.|..:...|.:||:||:.|.|.:::.:||..||:|:|....||||::..|
plant    75 VPPIRPIGRGACGIVCAAVNSVTGEKVAIKKIGNAFDNIIDAKRTLREIKLLRHMDHENVITIKD 139

  Fly   105 ILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKP 169
            |::||..|.|.::|::.||:.:||.:|:.|.|.|::|..:..:||:||||||:|||.|||||::|
plant   140 IVRPPQRDIFNDVYIVYELMDTDLQRILRSNQTLTSDQCRFLVYQLLRGLKYVHSANILHRDLRP 204

  Fly   170 GNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFG 234
            .|:|:||...|||.||||||.  ......||:.|||::|||||:|:....|::|:|:||||||.|
plant   205 SNVLLNSKNELKIGDFGLART--TSDTDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILG 267

  Fly   235 ELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHAT 299
            |::..:.||..::.|.||.|||||:|:|....:...........:|:.|:.|............|
plant   268 EIMTGQPLFPGKDYVHQLRLITELVGSPDNSSLGFLRSDNARRYVRQLPRYPKQQFAARFPKMPT 332

  Fly   300 HEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQ 364
             .|:.||.:||||||::||||.:||.|.||..     |..:.|                ||....
plant   333 -TAIDLLERMLVFDPNRRISVDEALGHAYLSP-----HHDVAK----------------EPVCST 375

  Fly   365 PFDDLWERKLTSVQQVKEEMHK 386
            ||...:|....:.:.:||.::|
plant   376 PFSFDFEHPSCTEEHIKELIYK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 140/347 (40%)
MPK12NP_001325006.1 STKc_TEY_MAPK 68..404 CDD:143363 140/347 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.