DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MPK6

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_181907.1 Gene:MPK6 / 818982 AraportID:AT2G43790 Length:395 Species:Arabidopsis thaliana


Alignment Length:424 Identity:163/424 - (38%)
Similarity:234/424 - (55%) Gaps:79/424 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AAGGAPQGASAILAAAAPYYQPPA---VPQDVQ-----------------------PDRPIGYGA 50
            |.||.|        ||||..|.|.   :|..:.                       |..|||.||
plant    17 APGGFP--------AAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGA 73

  Fly    51 FGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQ 115
            :|:|.:..:......||:||:.|.|.:.:.:||..||:|:|....|||:::..||:.||..:.|.
plant    74 YGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIVAIRDIIPPPLRNAFN 138

  Fly   116 EIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVL 180
            ::|:..||:.:|||:||.|.|.||.:|.:.|||||||||||:|||.:||||:||.|||:|:||.|
plant   139 DVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDL 203

  Fly   181 KICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQA 245
            ||||||||||  ..::..||:.|||::|||||:|:.:..|::|:|||||||||.||:.|:.||..
plant   204 KICDFGLARV--TSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPG 266

  Fly   246 QNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKP-----PSFSVLYTLSSHATHEAVHL 305
            ::.|.||.|:.||:|||:.|::....|.|:.::.:..|.|     ..|..::.|       |:.|
plant   267 RDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPL-------AIDL 324

  Fly   306 LCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQPFDDLW 370
            :.:||.|||.:||:|.||||||||:.                     .:....||....||:..:
plant   325 IEKMLTFDPRRRITVLDALAHPYLNS---------------------LHDISDEPECTIPFNFDF 368

  Fly   371 ERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQ 404
            |....|.:|:||.::          |..|..||:
plant   369 ENHALSEEQMKELIY----------REALAFNPE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 152/394 (39%)
MPK6NP_181907.1 STKc_TEY_MAPK 56..391 CDD:143363 150/374 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.