DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and si:ch211-220i18.4

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_021325577.1 Gene:si:ch211-220i18.4 / 798392 ZFINID:ZDB-GENE-090312-151 Length:448 Species:Danio rerio


Alignment Length:362 Identity:102/362 - (28%)
Similarity:147/362 - (40%) Gaps:100/362 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFR-ELKMLCFFKHENVLSALD--ILQ 107
            :|:|.|..||...|.|.||.||:|    |.:|.....:..: ||.:|.........:.|.  |:|
Zfish   107 LGWGYFSTVWLCVDLRSGRHVAVK----VLKSGAGFTQAGQDELTLLRCASGPTARNPLKGRIVQ 167

  Fly   108 PPHLDFFQ-------EIYVITELLQSDLH--KIIVSPQHLSADHIKVFLYQILRGLKYLHS-ARI 162
              .||.|:       .|.::.|||..||.  ::......||...:|..:.|:|.||:|||| .:|
Zfish   168 --LLDEFKLAGVNGIHICLVLELLGPDLRCWQMCFGNPGLSLSCVKHVITQVLEGLEYLHSHCKI 230

  Fly   163 LHRDIKPGNLLV--------------NSNCV------------------------LKICDFGLAR 189
            :|.||||.|:|:              :|:.:                        :||.|.|   
Zfish   231 IHTDIKPENILLCFTPHPPGGDIHTYSSSAIRNTVLKAPGESGKLGTWGNLEDITVKIADLG--- 292

  Fly   190 VEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQ-NPVQQLE 253
             ......||..||:.|:.||:.|:|:|: .|..|.|:|||.|:..||.....||:.: .|...||
Zfish   293 -SSCWVYKHFCQEIQTRQYRSLEVLLGS-EYGPAADIWSVACLAFELATGDSLFEPKAGPNFSLE 355

  Fly   254 -----LITELLGTPTME----------------DMRHACEGARTHMLRRAPKPP--SFSVLYTLS 295
                 .|.||||...:.                |:|      |..:||     |  .:.||....
Zfish   356 EDHLAHIIELLGKIPVSVAQCGKYYYEYFNRKGDLR------RIAVLR-----PWGLYEVLVEKY 409

  Fly   296 SHATHEA---VHLLCQMLVFDPDKRISVTDALAHPYL 329
            .....||   ...|.|||.:.|::|.:....|.||:|
Zfish   410 HFLLREASLFSDFLLQMLNYLPERRATAAQCLKHPWL 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 102/362 (28%)
si:ch211-220i18.4XP_021325577.1 STKc_SRPK 90..446 CDD:271038 101/360 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575931
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.