DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and mapk7

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001072332.1 Gene:mapk7 / 779785 XenbaseID:XB-GENE-5881331 Length:925 Species:Xenopus tropicalis


Alignment Length:346 Identity:153/346 - (44%)
Similarity:219/346 - (63%) Gaps:36/346 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQP-- 108
            ||.||:|||.:......|:|||:||:||.|..:.::||..||||:|..|||:|:::..|||:|  
 Frog    56 IGVGAYGVVSSARRKGCGQRVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILKPSV 120

  Fly   109 PHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLL 173
            |:.| |:.:||:.:|::||||:||.|.|.|:.:|.:.||||:||||||:|||.:||||:||.|||
 Frog   121 PYND-FRSVYVVLDLMESDLHQIIHSSQPLTLEHARYFLYQLLRGLKYIHSANVLHRDLKPSNLL 184

  Fly   174 VNSNCVLKICDFGLAR--VEEPDQAKH-MTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGE 235
            :|.||.|||.|||:||  ..:||:.|: ||:.|.|::||.||:::....|:.|:|:|||||||.|
 Frog   185 INENCELKIGDFGMARGLCTKPDEYKYFMTEYVATRWYRPPELMLSLHEYTQAIDMWSVGCIFAE 249

  Fly   236 LLGRRILFQAQNPVQQLELITELLGTPTMEDMRH-ACEGARTH---MLRRAPKPPSFSVLYTLSS 296
            :|||:.||..:|.:.||.||..:||||:.:.:|. ..|..|.:   :..|.|.|.:     ||..
 Frog   250 MLGRKPLFPGKNYLHQLHLIMTVLGTPSSQVIRAIGAERVRAYIQSLPSRQPVPWA-----TLYP 309

  Fly   297 HATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPS 361
            .|..:|:.||.:||.|||..||||.:||.||:|.    :||.                 .|.||.
 Frog   310 QAGKKALDLLSKMLRFDPRDRISVAEALRHPFLS----KYHD-----------------PDDEPE 353

  Fly   362 AGQPFDDLWERKLTSVQQVKE 382
            ....||..:::|:.:..|:||
 Frog   354 CIPAFDFGFDKKILTKDQIKE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 153/346 (44%)
mapk7NP_001072332.1 STKc_ERK5 44..379 CDD:270842 153/346 (44%)
S_TKc 50..342 CDD:214567 141/291 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.