DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and SRPK2

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_024302662.1 Gene:SRPK2 / 6733 HGNCID:11306 Length:767 Species:Homo sapiens


Alignment Length:219 Identity:59/219 - (26%)
Similarity:84/219 - (38%) Gaps:63/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KPGNLLVN-------SNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVD 225
            :..:||||       ....:||.|.|.|....    ||.|:::.|:.||:.|:|:|| .||:..|
Human   555 RAADLLVNPLDPRNADKIRVKIADLGNACWVH----KHFTEDIQTRQYRSIEVLIGA-GYSTPAD 614

  Fly   226 VWSVGCIFGELLGRRILFQAQ-------------------------------------NPVQQLE 253
            :||..|:..||.....||:..                                     |....:.
Human   615 IWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRDHIA 679

  Fly   254 LITELLG-TPTMEDM--RHACE-----GARTHMLRRAPKPPS-FSVL---YTLSSHATHEAVHLL 306
            ||.|||| .|....|  :::.|     |...|:.:.  ||.| |.||   |........:....|
Human   680 LIIELLGKVPRKYAMLGKYSKEFFTRKGELRHITKL--KPWSLFDVLVEKYGWPHEDAAQFTDFL 742

  Fly   307 CQMLVFDPDKRISVTDALAHPYLD 330
            ..||...|:||.|..:.|.||:|:
Human   743 IPMLEMVPEKRASAGECLRHPWLN 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 59/219 (27%)
SRPK2XP_024302662.1 STKc_SRPK2 116..>304 CDD:271119
Na_Ca_ex <389..431 CDD:332332
PKc_like <552..765 CDD:328722 58/216 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.