DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MAPK12

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_002960.2 Gene:MAPK12 / 6300 HGNCID:6874 Length:367 Species:Homo sapiens


Alignment Length:368 Identity:133/368 - (36%)
Similarity:213/368 - (57%) Gaps:42/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AVPQDVQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENV 99
            ||.:|:|   |:|.||:|.|.:..|.|.|.:||:|||...|||.:.:||.:|||::|...:||||
Human    25 AVYRDLQ---PVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENV 86

  Fly   100 LSALDILQPPH-LDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARIL 163
            :..||:..|.. ||.|.:.|::...:.:||.| ::..:.|..|.|:..:||:|:||:|:|:|.|:
Human    87 IGLLDVFTPDETLDDFTDFYLVMPFMGTDLGK-LMKHEKLGEDRIQFLVYQMLKGLRYIHAAGII 150

  Fly   164 HRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWS 228
            |||:|||||.||.:|.|||.||||||..:.:    ||..|||::|||||:::....|:..||:||
Human   151 HRDLKPGNLAVNEDCELKILDFGLARQADSE----MTGYVVTRWYRAPEVILNWMRYTQTVDIWS 211

  Fly   229 VGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDM-RHACEGARTHM--LRRAPKPPSFSV 290
            ||||..|::..:.||:..:.:.||:.|.::.|||..|.: |...:.|:.:|  |....|....|:
Human   212 VGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASI 276

  Fly   291 LYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYT 355
            |    ::|:..||:||.:|||.|.::|::..:||||||.:.                     .:.
Human   277 L----TNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFES---------------------LHD 316

  Fly   356 ADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVP 398
            .:.||.. |.:||.::    .|.:..:|..:...:::.:.:.|
Human   317 TEDEPQV-QKYDDSFD----DVDRTLDEWKRVTYKEVLSFKPP 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 131/364 (36%)
MAPK12NP_002960.2 STKc_p38gamma 11..353 CDD:143385 132/365 (36%)
TXY 183..185 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.