DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and mapk10

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001305248.1 Gene:mapk10 / 569698 ZFINID:ZDB-GENE-051120-117 Length:486 Species:Danio rerio


Alignment Length:407 Identity:147/407 - (36%)
Similarity:220/407 - (54%) Gaps:61/407 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQP 108
            :|||.||.|:|.|..|....|.||:|||...||:...:||.:|||.::....|:|::|.|::..|
Zfish    68 KPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTP 132

  Fly   109 -PHLDFFQEIYVITELLQSDLHKIIVSPQHLSADH--IKVFLYQILRGLKYLHSARILHRDIKPG 170
             ..|:.||::|::.||:.::|.::|    .:..||  :...|||:|.|:|:||||.|:|||:||.
Zfish   133 QKSLEEFQDVYLVMELMDANLCQVI----QMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPS 193

  Fly   171 NLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGE 235
            |::|.|:|.|||.||||||.  ...:..||..|||:||||||:::| ..|...||:||||||.||
Zfish   194 NIVVKSDCTLKILDFGLART--AGTSFMMTPYVVTRYYRAPEVILG-MGYKENVDIWSVGCIMGE 255

  Fly   236 LLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPK------PPSF-SVLYT 293
            ::..:|||..::.:.|...:.|.||||:.|.|:......|.::..| ||      |..| ..|:.
Zfish   256 MVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVENR-PKYAGLTFPKLFPDCLFP 319

  Fly   294 LSSH----ATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQY 354
            ..|.    ...:|..||.:||:.||.|||||.:||.|||::   :.|.                 
Zfish   320 ADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYIN---VWYD----------------- 364

  Fly   355 TADFEPSAGQ----PFDDLWERKLT----SVQQVKEEMHKFI---AEQLQTGRVPLCINPQSAAF 408
            .|:.|.:..|    |...:::::|.    |:.:.||.::|.:   .|:.:.|.|....:|..||.
Zfish   365 PAEVEAARNQQISMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKGQPSPSGAAV 429

  Fly   409 KSFASSTVAHPSELPPS 425
            .|..|        ||||
Zfish   430 NSSES--------LPPS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 141/391 (36%)
mapk10NP_001305248.1 STKc_JNK 63..406 CDD:270840 135/365 (37%)
S_TKc 64..359 CDD:214567 124/298 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.