DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and zgc:171775

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001104637.1 Gene:zgc:171775 / 562552 ZFINID:ZDB-GENE-030131-4309 Length:359 Species:Danio rerio


Alignment Length:362 Identity:135/362 - (37%)
Similarity:198/362 - (54%) Gaps:46/362 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DVQ------PDR-----PIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLC 92
            |:|      |||     |:|.||:|.|....|.:...:||:|||...||||:.:||.:|||::|.
Zfish    13 DIQKTTWDVPDRYTSLKPVGSGAYGTVCFAVDQKTKEKVAIKKLYRPFQSLIHAKRAYRELRLLR 77

  Fly    93 FFKHENVLSALDILQP-PHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKY 156
            ..:|:||:..|::..| ..|:.|...|::...:..||..|:...| |:::.|....|||||||||
Zfish    78 HIQHDNVICLLNVFTPDSSLEKFDTFYMVMPFVAQDLGHIMKRKQ-LTSNVITYLFYQILRGLKY 141

  Fly   157 LHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYS 221
            :|||.|:|||:||.||.|:.||.|||.||||||..|.:    ||..|||::|||||::....||:
Zfish   142 IHSAGIIHRDLKPNNLAVDENCELKILDFGLARHTETE----MTGYVVTRWYRAPEVIFNWMHYT 202

  Fly   222 SAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTME-DMRHACEGARTHMLRRAP-- 283
            ..||||:.|||..|::...:||...:.:.||:.|..|.|||... .::...:.|::: :|..|  
Zfish   203 QTVDVWTAGCILAEMITGEVLFPGSDSIDQLKKILNLTGTPNSTLVLKMQSKDAQSY-VRSLPVQ 266

  Fly   284 KPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTS 348
            |..:|..::   |.....|:.||..|||.||:.|:|..:.|:||||.|    :|.          
Zfish   267 KKKAFKEVF---SGMDPNAIDLLEGMLVLDPEVRLSAKNGLSHPYLSE----FHD---------- 314

  Fly   349 AGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKEEMH 385
                   .:.|| ...|:||.:|....:|.:.|..:|
Zfish   315 -------PENEP-VSPPYDDSFESMDLAVSEWKSLIH 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 135/362 (37%)
zgc:171775NP_001104637.1 STKc_p38 9..351 CDD:143356 135/362 (37%)
S_TKc 25..309 CDD:214567 117/292 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.