DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MAPK13

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_002745.1 Gene:MAPK13 / 5603 HGNCID:6875 Length:365 Species:Homo sapiens


Alignment Length:346 Identity:131/346 - (37%)
Similarity:198/346 - (57%) Gaps:33/346 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQP-P 109
            :|.||:|.|.:..|.|.|.:||:|||...|||.:.:||.:|||.:|...:||||:..||:..| .
Human    31 VGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPAS 95

  Fly   110 HLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLV 174
            .|..|.:.|::...:|:||.||:  ....|.:.|:..:||:|:||||:|||.::|||:|||||.|
Human    96 SLRNFYDFYLVMPFMQTDLQKIM--GMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAV 158

  Fly   175 NSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGR 239
            |.:|.|||.||||||..:.:    ||..|||::|||||:::...||:..||:||||||..|:|..
Human   159 NEDCELKILDFGLARHADAE----MTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTG 219

  Fly   240 RILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPP--SFSVLYTLSSHATHEA 302
            :.||:.::.:.||..|.::.|.|..|.::...:.|....::..|:.|  .|:.|:   ..|:.:|
Human   220 KTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLF---PRASPQA 281

  Fly   303 VHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQPFD 367
            ..||.:||..|.|||::...||.||:.:..|                     ..:.|..|.||||
Human   282 ADLLEKMLELDVDKRLTAAQALTHPFFEPFR---------------------DPEEETEAQQPFD 325

  Fly   368 DLWERKLTSVQQVKEEMHKFI 388
            |..|.:..:|.:.|:.::|.|
Human   326 DSLEHEKLTVDEWKQHIYKEI 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 131/346 (38%)
MAPK13NP_002745.1 STKc_p38delta 9..351 CDD:143384 131/346 (38%)
TXY 180..182 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.