DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MAPK10

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001304998.1 Gene:MAPK10 / 5602 HGNCID:6872 Length:478 Species:Homo sapiens


Alignment Length:399 Identity:148/399 - (37%)
Similarity:217/399 - (54%) Gaps:53/399 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQP 108
            :|||.||.|:|.|..|....|.||:|||...||:...:||.:|||.::....|:|::|.|::..|
Human    68 KPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTP 132

  Fly   109 PH-LDFFQEIYVITELLQSDLHKIIVSPQHLSADH--IKVFLYQILRGLKYLHSARILHRDIKPG 170
            .. |:.||::|::.||:.::|.::|    .:..||  :...|||:|.|:|:||||.|:|||:||.
Human   133 QKTLEEFQDVYLVMELMDANLCQVI----QMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPS 193

  Fly   171 NLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGE 235
            |::|.|:|.|||.||||||.  ...:..||..|||:||||||:::| ..|...||:||||||.||
Human   194 NIVVKSDCTLKILDFGLART--AGTSFMMTPYVVTRYYRAPEVILG-MGYKENVDIWSVGCIMGE 255

  Fly   236 LLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPK------PPSF--SVLY 292
            ::..:|||..::.:.|...:.|.||||..|.|:......|.::..| ||      |..|  |:..
Human   256 MVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENR-PKYAGLTFPKLFPDSLFP 319

  Fly   293 TLSSH---ATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQY 354
            ..|.|   ...:|..||.:|||.||.|||||.|||.|||::   :.|.                 
Human   320 ADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN---VWYD----------------- 364

  Fly   355 TADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFI---AEQLQTGRVPLCINPQSAAFKSFASSTV 416
            .|:.|....|.:|...:.:..::::.||.::|.:   .|:.:.|.|....:|..||..|..|   
Human   365 PAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSES--- 426

  Fly   417 AHPSELPPS 425
                 ||||
Human   427 -----LPPS 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 142/383 (37%)
MAPK10NP_001304998.1 STKc_JNK 63..398 CDD:270840 136/357 (38%)
S_TKc 64..359 CDD:214567 127/298 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.