DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MAPK9

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001351537.1 Gene:MAPK9 / 5601 HGNCID:6886 Length:424 Species:Homo sapiens


Alignment Length:400 Identity:148/400 - (37%)
Similarity:218/400 - (54%) Gaps:62/400 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQP 108
            :|||.||.|:|.|..|...|..||:|||...||:...:||.:|||.:|....|:|::|.|::..|
Human    30 KPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTP 94

  Fly   109 PH-LDFFQEIYVITELLQSDLHKIIVSPQHLSADH--IKVFLYQILRGLKYLHSARILHRDIKPG 170
            .. |:.||::|::.||:.::|.::|    |:..||  :...|||:|.|:|:||||.|:|||:||.
Human    95 QKTLEEFQDVYLVMELMDANLCQVI----HMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPS 155

  Fly   171 NLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGE 235
            |::|.|:|.|||.||||||....:..  ||..|||:||||||:::| ..|...||:||||||.||
Human   156 NIVVKSDCTLKILDFGLARTACTNFM--MTPYVVTRYYRAPEVILG-MGYKENVDIWSVGCIMGE 217

  Fly   236 LLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPP--SFSVLY---TLS 295
            |:...::||..:.:.|...:.|.||||:.|.|:......|.::..| ||.|  .|..|:   ...
Human   218 LVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENR-PKYPGIKFEELFPDWIFP 281

  Fly   296 SHA------THEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQY 354
            |.:      |.:|..||.:|||.||||||||.:||.|||:                         
Human   282 SESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYI------------------------- 321

  Fly   355 TADFEPSAG-----QPFDDLWERKLTSVQQVKEEMHKFI---AEQLQTGRVPLCINPQSAAFKSF 411
            |..::|:..     |.:|...|.:..::::.||.::|.:   .|:.:.|.|.  ..|..||..|.
Human   322 TVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVK--DQPSDAAVSSN 384

  Fly   412 ASSTVAHPSE 421
            |:     ||:
Human   385 AT-----PSQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 144/388 (37%)
MAPK9NP_001351537.1 STKc_JNK 25..360 CDD:270840 138/362 (38%)
TXY 183..185 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..424 9/28 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.