DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and MAPK3

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_002737.2 Gene:MAPK3 / 5595 HGNCID:6877 Length:379 Species:Homo sapiens


Alignment Length:409 Identity:149/409 - (36%)
Similarity:234/409 - (57%) Gaps:62/409 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VSMSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQ--PDRP------------IGYGAFGV 53
            ::.:..||| .||.|:....:         .|.||.:|:  ..:|            ||.||:|:
Human     1 MAAAAAQGG-GGGEPRRTEGV---------GPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGM 55

  Fly    54 VWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIY 118
            |.:..|.....|||:||: :.|:.....:|..||:::|..|:||||:...|||:...|:..:::|
Human    56 VSSAYDHVRKTRVAIKKI-SPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVY 119

  Fly   119 VITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKIC 183
            ::.:|:::||:|::.| |.||.|||..|||||||||||:|||.:||||:||.|||:|:.|.||||
Human   120 IVQDLMETDLYKLLKS-QQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKIC 183

  Fly   184 DFGLARVEEP--DQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQ 246
            ||||||:.:|  |....:|:.|.|::||||||::.::.|:.::|:||||||..|:|..|.:|..:
Human   184 DFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK 248

  Fly   247 NPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPP--SFSVLYTLSSHATHEAVHLLCQM 309
            :.:.||..|..:||:|:.||:.........:.|:..|...  :::.|:..|.   .:|:.||.:|
Human   249 HYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD---SKALDLLDRM 310

  Fly   310 LVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQPF------DD 368
            |.|:|:|||:|.:|||||||::                     .|....||.|.:||      ||
Human   311 LTFNPNKRITVEEALAHPYLEQ---------------------YYDPTDEPVAEEPFTFAMELDD 354

  Fly   369 LWERKLTSVQQVKEEMHKF 387
            |.:.:|..:  :.:|..:|
Human   355 LPKERLKEL--IFQETARF 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 140/373 (38%)
MAPK3NP_002737.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 8/34 (24%)
STKc_ERK1_2_like 36..370 CDD:270839 137/361 (38%)
TXY 202..204 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.