DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and Mapk3

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_038944453.1 Gene:Mapk3 / 50689 RGDID:3046 Length:406 Species:Rattus norvegicus


Alignment Length:419 Identity:153/419 - (36%)
Similarity:236/419 - (56%) Gaps:72/419 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GAAGGAPQGASAILAAAAPYYQPPAVPQDVQ--PDRP------------IGYGAFGVVWAVTDPR 61
            |..||.|:|.:.::         |.||.:|:  ..:|            ||.||:|:|.:..|..
  Rat     9 GGGGGEPRGTAGVV---------PVVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHV 64

  Fly    62 DGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQS 126
            ...|||:||: :.|:.....:|..||:::|..|:||||:...|||:.|.|:..:::|::.:|:::
  Rat    65 RKTRVAIKKI-SPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMET 128

  Fly   127 DLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVE 191
            ||:|::.| |.||.|||..|||||||||||:|||.:||||:||.|||:|:.|.||||||||||:.
  Rat   129 DLYKLLKS-QQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIA 192

  Fly   192 EP--DQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLEL 254
            :|  |....:|:.|.|::||||||::.::.|:.::|:||||||..|:|..|.:|..::.:.||..
  Rat   193 DPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNH 257

  Fly   255 ITELLGTPTMEDMRHACEGARTHMLRRAPKPP--SFSVLYTLSSHATHEAVHLLCQMLVFDPDKR 317
            |..:||:|:.||:.........:.|:..|...  :::.|:..|.   .:|:.||.:||.|:|:||
  Rat   258 ILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD---SKALDLLDRMLTFNPNKR 319

  Fly   318 ISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKE 382
            |:|.:|||||||::    |:.       .|....|      .|:||:..         ||..|:.
  Rat   320 ITVEEALAHPYLEQ----YYD-------PTDEVSR------PPAAGRGI---------SVPSVRP 358

  Fly   383 EMHKFIAEQLQTGRVPLCINPQSAAFKSF 411
                          ||.|:.||..|.:.|
  Rat   359 --------------VPYCLCPQPVAEEPF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 144/389 (37%)
Mapk3XP_038944453.1 STKc_ERK1_2_like 37..397 CDD:270839 143/382 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.