DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and Srpk79D

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001246881.1 Gene:Srpk79D / 40461 FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster


Alignment Length:177 Identity:50/177 - (28%)
Similarity:77/177 - (43%) Gaps:21/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 NLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGE 235
            :|:.|||..:||.|.|.|..:    ..|.|:::.|:.||:.|:|:|| .|:...|:||..|:..|
  Fly   843 SLIDNSNVRVKIADLGNACYD----YHHFTEDIQTRQYRSIEVLLGA-PYNYTADIWSTACLAFE 902

  Fly   236 LLGRRILFQA------QNPVQQLELITELLGTPTMEDMRHACEGARTH----MLRRAPKPPSFSV 290
            |.....||..      ......|..|.||||:.....:.....|.:..    .||...|...:|:
  Fly   903 LATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSL 967

  Fly   291 LYTLSSHATHEAVH------LLCQMLVFDPDKRISVTDALAHPYLDE 331
            :..|......:.|.      .|..||.::|..|.|..:.|.||:|::
  Fly   968 MNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWLEQ 1014

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 50/177 (28%)
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038
S_TKc 347..>492 CDD:214567
STKc_SRPK <844..1012 CDD:271038 49/172 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.