DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and SRPK

DIOPT Version :10

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001369087.1 Gene:SRPK / 36706 FlyBaseID:FBgn0286813 Length:1009 Species:Drosophila melanogaster


Alignment Length:175 Identity:52/175 - (29%)
Similarity:76/175 - (43%) Gaps:33/175 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 NCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRI 241
            |..:||.|.|.|...:    :|.|:::.|:.||:.|:::|| .|:::.|:||..|:..||.....
  Fly   600 NVHVKIADLGNACWVD----RHFTEDIQTRQYRSLEVIIGA-GYNTSADIWSTACMVFELATGDY 659

  Fly   242 LFQAQN------PVQQLELITELL----------GTPTMEDMRHACEGARTHMLRRAP--KP-PS 287
            ||:..:      ....|..|.|||          ||...:....:||      ||...  || ..
  Fly   660 LFEPHSGESYTRDEDHLAHIIELLGPIPREILLNGTYAAKSFTRSCE------LRNISGLKPWGL 718

  Fly   288 FSVL---YTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYL 329
            ..||   |..|..........|..||.|||:||.:..:.|.||:|
  Fly   719 MDVLLEKYEWSQKDAASFASFLTPMLEFDPNKRATAAECLQHPWL 763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 52/175 (30%)
SRPKNP_001369087.1 Protein Kinases, catalytic domain 159..>318 CDD:473864
Protein Kinases, catalytic domain <600..763 CDD:473864 51/173 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.