DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and F09C12.2

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_872069.1 Gene:F09C12.2 / 353395 WormBaseID:WBGene00017277 Length:418 Species:Caenorhabditis elegans


Alignment Length:297 Identity:110/297 - (37%)
Similarity:176/297 - (59%) Gaps:17/297 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPH 110
            :|.||||||....|.:..::||:||:..||::..::|...||:::.....|||::::.|:|. ..
 Worm    50 LGAGAFGVVCRAIDSKLNKQVAIKKITRVFKNQSTAKCALREIRITRELSHENIINSTDVLM-RE 113

  Fly   111 LDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVN 175
            ....|:||::.:|:::||..::.|.|.|:..|.:.|.||||:||||||||.|:|||:||.|||:|
 Worm   114 SGSGQDIYIVMDLMETDLLSVLKSNQTLNEKHFQYFFYQILKGLKYLHSAGIIHRDLKPANLLLN 178

  Fly   176 SNCVLKICDFGLAR-----VEEPDQAKH------MTQEVVTQYYRAPEILMGARHYSSAVDVWSV 229
            .:|.|||.|||::|     ...|:.:.:      ::|.|.|.:|||||||:....|.:.||:||.
 Worm   179 EDCSLKIADFGMSRSGPSTKTTPNTSPNAHISGDLSQYVSTLWYRAPEILLSMGEYDTQVDIWSA 243

  Fly   230 GCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRH-ACEGARTHMLRRAPKPP-SFSVLY 292
            |||..|:|..|.:|...:...|::|:.|.||||..:.:|. .....|.::....||.| .|:.::
 Worm   244 GCILAEMLLLRPIFTGTDSYSQIQLLIEYLGTPDEQVIRRIKSPSIRDYISSFGPKTPLPFTAMF 308

  Fly   293 TLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYL 329
               .:|:.||.:::.:||...|.||.|....|..|::
 Worm   309 ---PNASIEARNIVSKMLQISPWKRFSAEQLLEEPFV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 110/297 (37%)
F09C12.2NP_872069.1 STKc_MAPK 44..355 CDD:270828 110/297 (37%)
S_TKc 44..342 CDD:214567 110/295 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.