DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and CG42366

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster


Alignment Length:347 Identity:105/347 - (30%)
Similarity:170/347 - (48%) Gaps:25/347 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPH 110
            :|.|.:|.|........|.:||:|::...:.|...:..: ||:|.|....|.|::...::::.. 
  Fly    10 LGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEAMNL-REVKSLKKLSHPNIVKLKEVIREN- 72

  Fly   111 LDFFQEIYVITELLQSDLHKIIVS-PQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLV 174
                ..:|.:.|.::.:|:::|.. ..||....:|..|:|:|.||.::|.....|||:||.|||.
  Fly    73 ----DTLYFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFFHRDLKPENLLC 133

  Fly   175 NSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGR 239
            :...::||.||||||  |.......|..|.|::|||||:|:.:.:|.|.:|:|::|||..||...
  Fly   134 SGPDLIKIADFGLAR--EIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGCIMAELYTF 196

  Fly   240 RILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSV-LYTLSSHATHEAV 303
            |.||...:.|.||..|..:||||..:|..   :|.|...:.....|....| |.::.|..:...:
  Fly   197 RPLFPGSSEVDQLFKICSVLGTPDKDDWP---DGYRLASMIHFRYPDCIKVPLSSVVSRCSQNGL 258

  Fly   304 HLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSC-MCKCCFTTSAGMRQYTADFEPSAGQPFD 367
            .||..||.:|||||.:...:|.:||       :|:. .......|.|.:| ..:.:..|.|.|..
  Fly   259 DLLEDMLAYDPDKRPTAQQSLKYPY-------FHALKRISPTAATKANVR-LNSKYAASNGHPVQ 315

  Fly   368 DLWERKL---TSVQQVKEEMHK 386
            .:....|   ..:|.|.|.:|:
  Fly   316 SVSNNVLPVQEKLQAVTELLHQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 105/347 (30%)
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 93/291 (32%)
S_TKc 4..284 CDD:214567 93/291 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.