DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and rl

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:405 Identity:153/405 - (37%)
Similarity:227/405 - (56%) Gaps:57/405 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SMSLVQGGAAGGAPQGASAILAA----AAPYYQPPAVPQDVQPDRPIGYGAFGVVWAVTDPRDGR 64
            |.|:|.|..:...||..:.::..    ..|.|...|.         ||.||:|:|.:..|....:
  Fly     7 SGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAY---------IGEGAYGMVVSADDTLTNQ 62

  Fly    65 RVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLH 129
            |||:||: :.|:.....:|..||:.:|..|||||::...|||:...:|..:::|::..|:::||:
  Fly    63 RVAIKKI-SPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLY 126

  Fly   130 KIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEP- 193
            |:: ..|.||.|||..|||||||||||:|||.:||||:||.|||:|..|.||||||||||:.:| 
  Fly   127 KLL-KTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPE 190

  Fly   194 -DQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITE 257
             |....:|:.|.|::||||||::.::.|:.::|:||||||..|:|..|.:|..::.:.||..|..
  Fly   191 HDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG 255

  Fly   258 LLGTPTMEDMRHAC---EGARTHMLRRAPKPPS--FSVLYTLSSHATHEAVHLLCQMLVFDPDKR 317
            :||:|:.:|:.  |   |.||.: |...|..|:  ::.|:   .:|...|:.||.:||.|:|.||
  Fly   256 VLGSPSRDDLE--CIINEKARNY-LESLPFKPNVPWAKLF---PNADALALDLLGKMLTFNPHKR 314

  Fly   318 ISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQPF------DDLWERKLTS 376
            |.|.:|||||||::                     .|....||.|..||      ||:....|.|
  Fly   315 IPVEEALAHPYLEQ---------------------YYDPGDEPVAEVPFRINMENDDISRDALKS 358

  Fly   377 VQQVKEEMHKFIAEQ 391
            :  :.||..||...|
  Fly   359 L--IFEETLKFKERQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 144/366 (39%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 144/373 (39%)
S_TKc 38..326 CDD:214567 129/304 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.